SLC39A1 Recombinant Protein (Human)
Online Inquiry

SLC39A1 Recombinant Protein (Human)

Cat. No. IP23038
Product Size    

Product Details

Product Name
SLC39A1 Recombinant Protein (Human)
Description
Recombinant human Zinc transporter ZIP1 protein.
Species Reactivity
Human
UniProt ID
Q9NY26
Protein Name
Zinc transporter ZIP1
Protein Sequence
MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR
Protein Size
126-179 aa
Tag
N-terminal 6xHis-tagged
Protein Range
126-179 aa
Molecular Weight
9.6 kDa
Purity
Greater than 90% as determined by SDS-PAGE.
Source
E. Coli

Usage

Additional Information
Tag information: GST tag.

Target Information

Gene Name
Solute carrier family 39 member 1
Gene Abbr.
SLC39A1
Gene ID
Alias
Solute carrier family 39 member 1Zinc-iron-regulated transporter-likeZrt- and Irt-like protein 1, ZIP-1, Hzip1

Storage & Handling

Storage
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Product Format
Liquid or Lyophilized powder.
Reconstitution
We recommend that this vial be briefly centrifμged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 °C/-80 °C. Our default final concentration of glycerol is 50%. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 °C/-80 °C. The shelf life of lyophilized form is 12 months at -20 °C/-80 °C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 °C for up to one week.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
Related Products