Products
Online Inquiry
Pezadeftide is a potent antifungal peptide that enters fungal cells, inducing a rapid mitochondrial response and membrane hyperpolarization.
Formula | C234H372N70O66S8 |
---|---|
Molecular Weight | 5478.41 |
Biological Target | Antibiotic |
Research Areas | Inflammation/Immunology, Others |
Sequence | Ala-Lys-Val-Cys-Thr-Lys-Pro-Ser-Lys-Phe-Phe-Lys-Gly-Leu-Cys-Gly-Thr-Asp-Gly-Ala-Cys-Thr-Thr-Ala-Cys-Arg-Lys-Glu-Gly-Leu-His-Ser-Gly-Tyr-Cys-Gln-Leu-Lys-Gly-Phe-Leu-Asn-Ser-Val-Cys-Val-Cys-Arg-Lys-His-Cys (Disulfide bridge:Cys4-Cys51, Cys15-Cys35, Cys21-Cys45, Cys25-Cys47) |
Sequence Shortening | AKVCTKPSKFFKGLCGTDGACTTACRKEGLHSGYCQLKGFLNSVCVCRKHC (Disulfide bridge:Cys4-Cys51, Cys15-Cys35, Cys21-Cys45, Cys25-Cys47) |
Shipping Conditions | Room Temperature |
Storage Information | Powder: -80°C (2 years), -20°C (1 year); In solvent: -80°C (6 months), -20°C (1 month) |