Products
Online Inquiry
SHLP-3, a mitochondrial-derived peptide encoded by the 16S ribosomal RNA (MT-RNR2) gene, enhances cell viability and reduces apoptosis in insulinoma NIT-1β and human prostate cancer 22Rv1 cells. It improves mitochondrial function and provides cytoprotection by increasing OCR, cellular ATP, and reducing ROS production. It's used in diabetes and cancer research.
| Formula | C214H301N47O49S2 |
|---|---|
| Molecular Weight | 4380.10 |
| Biological Target | Apoptosis; Reactive Oxygen Species |
| Research Areas | Metabolic Disease, Cancer |
| Sequence | Met-Leu-Gly-Tyr-Asn-Phe-Ser-Ser-Phe-Pro-Cys-Gly-Thr-Ile-Ser-Ile-Ala-Pro-Gly-Phe-Asn-Phe-Tyr-Arg-Leu-Tyr-Phe-Ile-Trp-Val-Asn-Gly-Leu-Ala-Lys-Val-Val-Trp |
| Sequence Shortening | MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW |
| Shipping Conditions | Room Temperature |
| Storage Information | Powder: -80°C (2 years), -20°C (1 year); In solvent: -80°C (6 months), -20°C (1 month) |