ISCU Recombinant Protein (Human)
Online Inquiry

ISCU Recombinant Protein (Human)

Cat. No. IP23031
Product Size    

Product Details

Product Name
ISCU Recombinant Protein (Human)
Description
Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins.
Species Reactivity
Human
UniProt ID
Q9H1K1
Protein Name
Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
Protein Sequence
YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
Protein Size
1-167 aa
Tag
N-terminal 10xHis-tagged
Protein Range
35-167 aa
Molecular Weight
18.0 kDa
Purity
Greater than 85% as determined by SDS-PAGE.
Source
E. Coli

Usage

Additional Information
Species Specificity Detail: Homo sapiens (Human).
Formulation
Tris-base, 50% glycerol

Target Information

Gene Name
Iron-sulfur cluster assembly enzyme
Gene Abbr.
ISCU
Gene ID
Alias
NifU-like N-terminal domain-containing protein (NifU-like protein) (NIFUN)

Storage & Handling

Storage
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Product Format
Liquid or Lyophilized powder.
Reconstitution
We recommend that this vial be briefly centrifμged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 °C/-80 °C. Our default final concentration of glycerol is 50%. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 °C/-80 °C. The shelf life of lyophilized form is 12 months at -20 °C/-80 °C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 °C for up to one week.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
Related Products