Online Inquiry
Inquiry
Recombinant Human Galectin-13 Protein, N-His
Description
Bind beta-galactoside and lactose. Induce T-cell apoptosis strongly. Possess hemagglutinating activity towards chicken erythrocytes.
Basic Information
Synonyms: | LGALS13, GAL13, PLAC8, PP13 |
Source/Host: | E.coli |
Tag: | N-His |
Mol_Mass: | 16.94 kDa |
Uniprot: | Q9UHV8 |
Accession: | Q9UHV8 |
Sequence: | MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN |
Species: | Human |
Product Properties
Endotoxin Level: | < 0.1 EU per μg (LAL method). |
Formulation: | Lyophilized from sterile PBS, pH 7.4 Prior to lyophilization, add protectants including 5% - 8% trehalose, mannitol, and 0.01% Tween80. |
Purity: | > 95 % (by reducing SDS-PAGE). |
Shipping and Handling
Shipping: | Shipped with ice packs (the product is lyophilized powder). |
Stability & Storage: | Please store lyophilized proteins at temperatures between -20 to -80°C for a maximum of 12 months. Once reconstituted, the protein solution can be stored at temperatures ranging from 4-8°C for a period of 2-7 days. If you need to store aliquots of reconstituted samples, please ensure they are kept below -20°C and they will remain stable for up to 3 months. |
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.