Solutions
Online Inquiry

Please note that we are not a pharmacy or clinic, so we are unable to see patients and do not offer diagnostic and treatment services for individuals.

Inquiry

Recombinant Human Galectin-13 Protein, N-His

Product Name: Recombinant Human Galectin-13 Protein, N-His
CAT#: DBBDRP-2402-LGZ-144
Datasheet

Description

Bind beta-galactoside and lactose. Induce T-cell apoptosis strongly. Possess hemagglutinating activity towards chicken erythrocytes.

Basic Information

Synonyms: LGALS13, GAL13, PLAC8, PP13
Source/Host: E.coli
Tag: N-His
Mol_Mass: 16.94 kDa
Uniprot: Q9UHV8
Accession: Q9UHV8
Sequence: MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN
Species: Human

Product Properties

Endotoxin Level: < 0.1 EU per μg (LAL method).
Formulation: Lyophilized from sterile PBS, pH 7.4
Prior to lyophilization, add protectants including 5% - 8% trehalose, mannitol, and 0.01% Tween80.
Purity: > 95 % (by reducing SDS-PAGE).

Shipping and Handling

Shipping: Shipped with ice packs (the product is lyophilized powder).
Stability & Storage: Please store lyophilized proteins at temperatures between -20 to -80°C for a maximum of 12 months. Once reconstituted, the protein solution can be stored at temperatures ranging from 4-8°C for a period of 2-7 days. If you need to store aliquots of reconstituted samples, please ensure they are kept below -20°C and they will remain stable for up to 3 months.

All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Copyright © Protheragen. All rights reserves.